Recombinant Human EDNRA
Cat.No. : | EDNRA-28562TH |
Product Overview : | Recombinant fragment of Human Endothelin A Receptor with N terminal proprietary tag, 32.56kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 63 amino acids |
Description : | This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. |
Molecular Weight : | 32.560kDa inclusive of tags |
Tissue specificity : | Isoform 1, isoform 3 and isoform 4 are expressed in a variety of tissues, with highest levels in the aorta and cerebellum, followed by lung, atrium and cerebral cortex, lower levels in the placenta, kidney, adrenal gland, duodenum, colon, ventricle and li |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFK |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily. |
Gene Name | EDNRA endothelin receptor type A [ Homo sapiens ] |
Official Symbol | EDNRA |
Synonyms | EDNRA; endothelin receptor type A; endothelin-1 receptor; |
Gene ID | 1909 |
mRNA Refseq | NM_001166055 |
Protein Refseq | NP_001159527 |
MIM | 131243 |
Uniprot ID | P25101 |
Chromosome Location | 4 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; EGFR-dependent Endothelin signaling events, organism-specific biosystem; Endothelins, organism-specific biosystem; |
Function | G-protein coupled receptor activity; endothelin receptor activity; phosphatidylinositol phospholipase C activity; receptor activity; signal transducer activity; |
◆ Cell & Tissue Lysates | ||
EDNRA-6718HCL | Recombinant Human EDNRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDNRA Products
Required fields are marked with *
My Review for All EDNRA Products
Required fields are marked with *
0
Inquiry Basket