Recombinant Human EDN1 protein, GST-tagged

• Cat.No.: EDN1-34H
• Product Overview: Recombinant Human EDN1(1 a.a. - 212 a.a) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-212 a.a.
• Description: This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 50.8 kDa
• AA Sequence: MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVN TPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSK LGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: EDN1 endothelin 1 [ Homo sapiens ]
• Official Symbol: EDN1
• Synonyms: EDN1; endothelin 1; endothelin-1; ET1; preproendothelin-1; PPET1; HDLCQ7
• Gene ID: 1906
• mRNA Refseq: NM_001168319
• Protein Refseq: NP_001161791
• UniProt ID: P05305
• Chromosome Location: 6p24.1
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; EGFR-dependent Endothelin signaling events, organism-specific biosystem; Endothelins, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem
• Function: cytokine activity; endothelin A receptor binding; endothelin B receptor binding; endothelin B receptor binding; hormone activity