Recombinant Human EDN1 protein, GST-tagged

Description :	This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	50.8 kDa
AA Sequence :	MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVN TPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSK LGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Applications :	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Protein length :	1-212 a.a.

Gene Name	EDN1 endothelin 1 [ Homo sapiens ]
Official Symbol	EDN1
Synonyms	EDN1; endothelin 1; endothelin-1; ET1; preproendothelin-1; PPET1; HDLCQ7;
Gene ID	1906
mRNA Refseq	NM_001168319
Protein Refseq	NP_001161791
MIM
UniProt ID	P05305
Chromosome Location	6p24.1
Pathway	Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; EGFR-dependent Endothelin signaling events, organism-specific biosystem; Endothelins, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem;
Function	cytokine activity; endothelin A receptor binding; endothelin B receptor binding; endothelin B receptor binding; hormone activity;