Recombinant Human EDF1, His-tagged
| Cat.No. : | EDF1-28461TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-148 of Human EDF1 with N terminal His tag, 25kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene. |
| Conjugation : | HIS |
| Source : | E. coli |
| Tissue specificity : | Expressed in brain, liver, lung, kidney and heart (at protein level). Ubiquitously expressed. More abundant in heart, pancreas, liver, intestine and adipose tissues. |
| Form : | Lyophilised:Reconstitute with 48 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
| Sequences of amino acids : | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVET SKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVG KVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNN QVLGKIERAIGLKLRGKDIGKPIEKGPRAK |
| Sequence Similarities : | Contains 1 HTH cro/C1-type DNA-binding domain. |
| Protein length : | 1-148 a.a. |
| Full Length : | Full L. |
| Gene Name | EDF1 endothelial differentiation-related factor 1 [ Homo sapiens ] |
| Official Symbol | EDF1 |
| Synonyms | EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1; |
| Gene ID | 8721 |
| mRNA Refseq | NM_003792 |
| Protein Refseq | NP_003783 |
| MIM | 605107 |
| Uniprot ID | O60869 |
| Chromosome Location | 9q34.3 |
| Function | calmodulin binding; NOT histone acetyltransferase activity; NOT methyltransferase activity; protein binding; sequence-specific DNA binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDF1 Products
Required fields are marked with *
My Review for All EDF1 Products
Required fields are marked with *
0
Inquiry Basket
