Recombinant Human EDF1 protein, GST-tagged

• Cat.No.: EDF1-12280H
• Product Overview: Recombinant Human EDF1 protein(1-148 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-148 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: EDF1
• Synonyms: EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1; MBF1; EDF-1; MGC9058
• Gene ID: 8721
• mRNA Refseq: NM_003792
• Protein Refseq: NP_003783
• MIM: 605107
• UniProt ID: O60869