Recombinant Human EDC4, His-tagged
Cat.No. : | EDC4-28226TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1143-1385 of Human EDC4 with an N-terminal His Tag, approximately 28kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1143-1385 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 46 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LGTQEYLQQLESHMKSRKAREQEAREPVLAQLRGLVSTLQ SATEQMAATVAGSVRAEVQHQLHVAVGSLQESILAQVQ RIVKGEVSVALKEQQAAVTSSIMQAMRSAAGTPVPSAHLDCQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCE TVDPAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLK LSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAA |
Sequence Similarities : | Belongs to the WD repeat EDC4 family.Contains 4 WD repeats. |
Gene Name | EDC4 enhancer of mRNA decapping 4 [ Homo sapiens ] |
Official Symbol | EDC4 |
Synonyms | EDC4; enhancer of mRNA decapping 4; enhancer of mRNA-decapping protein 4; Ge 1; HEDLS; RCD 8; |
Gene ID | 23644 |
mRNA Refseq | NM_014329 |
Protein Refseq | NP_055144 |
MIM | 606030 |
Uniprot ID | Q6P2E9 |
Chromosome Location | 16q22.1 |
Pathway | Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; RNA degradation, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
EDC4-4136Z | Recombinant Zebrafish EDC4 | +Inquiry |
EDC4-2636M | Recombinant Mouse EDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
EDC4-1665R | Recombinant Rat EDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
EDC4-28226TH | Recombinant Human EDC4, His-tagged | +Inquiry |
EDC4-4984M | Recombinant Mouse EDC4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDC4-529HCL | Recombinant Human EDC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDC4 Products
Required fields are marked with *
My Review for All EDC4 Products
Required fields are marked with *
0
Inquiry Basket