Recombinant Human EDC4, GST-tagged

• Cat.No.: EDC4-8392H
• Product Overview: Recombinant Human EDC4(1302 a.a. - 1401 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1302-1401 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: PAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAE PHNSLGKAARRLSLMLHGLVTPSLP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: EDC4 enhancer of mRNA decapping 4 [ Homo sapiens ]
• Official Symbol: EDC4
• Synonyms: GE1; Ge-1; RCD8; HEDL5; HEDLS; RCD-8; enhancer of mRNA-decapping protein 4; autoantigen Ge-1; autoantigen RCD-8; human enhancer of decapping large subunit
• Gene ID: 23644
• mRNA Refseq: NM_014329
• Protein Refseq: NP_055144
• MIM: 606030
• UniProt ID: Q6P2E9
• Chromosome Location: 16q22.1
• Pathway: Deadenylation-dependent mRNA decay, organism-specific biosystem; Gene Expression, organism-specific biosystem; RNA degradation, organism-specific biosystem
• Function: protein binding