Recombinant Human EDAR Protein, His/Flag/StrepII-tagged

• Cat.No.: EDAR-3047H
• Product Overview: Purified EDAR (AAH93872.1, 27 a.a. - 183 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Specification

• Species: Human
• Source: Human Cells
• Tag: Flag&His&Strep II
• Protein Length: 27-183 a.a.
• Description: This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008]
• Form: Liquid
• Bio-activity: Not Tested
• Molecular Mass: 22.55 kDa
• AA Sequence: EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGH
• Applications: Western Blot
  Enzyme-linked Immunoabsorbent Assay
  SDS-PAGE
  Protein Interaction
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: ≥ 10 μg/mL
• Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.

Gene Information

• Gene Name: EDAR ectodysplasin A receptor [ Homo sapiens ]
• Official Symbol: EDAR
• Synonyms: EDAR; ectodysplasin A receptor; DL, ectodysplasin 1, anhidrotic receptor , ED3; tumor necrosis factor receptor superfamily member EDAR; ED1R; ED5; EDA1R; EDA3; Edar; EDA-A1 receptor; downless homolog; ectodysplasin-A receptor; downless, mouse, homolog of; ectodermal dysplasia receptor; anhidrotic ectodysplasin receptor 1; ectodysplasin 1, anhidrotic receptor; DL; ED3; HRM1; EDA-A1R; FLJ94390
• Gene ID: 10913
• mRNA Refseq: NM_022336
• Protein Refseq: NP_071731
• MIM: 604095
• UniProt ID: Q9UNE0