Recombinant Human EDAR Protein, GST-tagged

• Cat.No.: EDAR-3049H
• Product Overview: Human EDAR partial ORF ( NP_071731, 64 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq, Jul 2008]
• Molecular Mass: 38.39 kDa
• AA Sequence: TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EDAR ectodysplasin A receptor [ Homo sapiens ]
• Official Symbol: EDAR
• Synonyms: EDAR; ectodysplasin A receptor; DL, ectodysplasin 1, anhidrotic receptor , ED3; tumor necrosis factor receptor superfamily member EDAR; ED1R; ED5; EDA1R; EDA3; Edar; EDA-A1 receptor; downless homolog; ectodysplasin-A receptor; downless, mouse, homolog of; ectodermal dysplasia receptor; anhidrotic ectodysplasin receptor 1; ectodysplasin 1, anhidrotic receptor; DL; ED3; HRM1; EDA-A1R; FLJ94390
• Gene ID: 10913
• mRNA Refseq: NM_022336
• Protein Refseq: NP_071731
• MIM: 604095
• UniProt ID: Q9UNE0