Recombinant Human ECT2 protein, His-tagged
Cat.No. : | ECT2-2823H |
Product Overview : | Recombinant Human ECT2 protein(1-350 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAGKQEELIKALKDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSMLSLNTPNSNRKRR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | ECT2 |
Synonyms | ECT2; epithelial cell transforming sequence 2 oncogene; protein ECT2; ARHGEF31; epithelial cell-transforming sequence 2 oncogene; FLJ10461; MGC138291; |
Gene ID | 1894 |
mRNA Refseq | NM_001258315 |
Protein Refseq | NP_001245244 |
MIM | 600586 |
UniProt ID | Q9H8V3 |
◆ Recombinant Proteins | ||
ECT2-4977M | Recombinant Mouse ECT2 Protein | +Inquiry |
ECT2-3040H | Recombinant Human ECT2 Protein, GST-tagged | +Inquiry |
ECT2-1170Z | Recombinant Zebrafish ECT2 | +Inquiry |
Ect2-1661M | Recombinant Mouse Ect2 protein, His & GST-tagged | +Inquiry |
ECT2-2823H | Recombinant Human ECT2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECT2-6728HCL | Recombinant Human ECT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECT2 Products
Required fields are marked with *
My Review for All ECT2 Products
Required fields are marked with *
0
Inquiry Basket