Recombinant Human ECT2 Protein, GST-tagged

• Cat.No.: ECT2-3040H
• Product Overview: Human ECT2 partial ORF (AAH06838.1, 46 a.a. - 145 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 46-145 a.a.
• Description: The protein encoded by this gene is a guanine nucleotide exchange factor and transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of this gene is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2017]
• Molecular Mass: 36.63 kDa
• AA Sequence: LPKENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRAFSFSKTPKRALRRALMTSHGSVEGRSPSSNDKHVMSR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ECT2 epithelial cell transforming sequence 2 oncogene [ Homo sapiens ]
• Official Symbol: ECT2
• Synonyms: ECT2; epithelial cell transforming sequence 2 oncogene; protein ECT2; ARHGEF31; epithelial cell-transforming sequence 2 oncogene; FLJ10461; MGC138291
• Gene ID: 1894
• mRNA Refseq: NM_001258315
• Protein Refseq: NP_001245244
• MIM: 600586
• UniProt ID: Q9H8V3