Recombinant Human EBF4 Protein, GST-tagged

Cat.No. : EBF4-3023H
Product Overview : Human EBF4 full-length ORF ( AAH54347.1, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM, Mar 2008]
Molecular Mass : 35.5 kDa
AA Sequence : MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EBF4 early B-cell factor 4 [ Homo sapiens (human) ]
Official Symbol EBF4
Synonyms EBF4; early B-cell factor 4; Early B-Cell Factor 4; Olf-1/EBF-Like 4; O/E-4; COE4; OE-4; Transcription Factor COE4; KIAA1442; EBF-4; transcription factor COE4; olf-1/EBF-like 4
Gene ID 57593
mRNA Refseq NM_001110514
Protein Refseq NP_001103984
MIM 609935
UniProt ID Q9BQW3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EBF4 Products

Required fields are marked with *

My Review for All EBF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon