Recombinant Human EBF3 Protein, GST-tagged

Cat.No. : EBF3-3021H
Product Overview : Human EBF3 full-length ORF (1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma. [provided by RefSeq, Sep 2011]
Molecular Mass : 38.5 kDa
AA Sequence : MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKVSANTRSHPLSF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EBF3 early B-cell factor 3 [ Homo sapiens ]
Official Symbol EBF3
Synonyms EBF3; early B-cell factor 3; COE3; DKFZp667B0210;
Gene ID 253738
mRNA Refseq NM_001005463
Protein Refseq NP_001005463
MIM 607407
UniProt ID Q9H4W6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EBF3 Products

Required fields are marked with *

My Review for All EBF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon