Recombinant Full Length Human EBF3 Protein, GST-tagged

• Cat.No.: EBF3-4141HF
• Product Overview: Human EBF3 full-length ORF (1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 109 amino acids
• Description: This gene encodes a member of the early B-cell factor (EBF) family of DNA binding transcription factors. EBF proteins are involved in B-cell differentiation, bone development and neurogenesis, and may also function as tumor suppressors. The encoded protein inhibits cell survival through the regulation of genes involved in cell cycle arrest and apoptosis, and aberrant methylation or deletion of this gene may play a role in multiple malignancies including glioblastoma multiforme and gastric carcinoma. [provided by RefSeq, Sep 2011]
• Molecular Mass: 38.5 kDa
• AA Sequence: MFGIQENIPRGGTTMKEEPLGSGMNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVDFVEKEKVSANTRSHPLSF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EBF3 early B-cell factor 3 [ Homo sapiens ]
• Official Symbol: EBF3
• Synonyms: EBF3; early B-cell factor 3; COE3; DKFZp667B0210
• Gene ID: 253738
• mRNA Refseq: NM_001005463
• Protein Refseq: NP_001005463
• MIM: 607407
• UniProt ID: Q9H4W6