Recombinant Human EBF1 protein, GST-tagged
Cat.No. : | EBF1-321H |
Product Overview : | Recombinant Human EBF1(4-350aa) fused with GST tag at N-terminal was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 4-350 a.a. |
Description : | EBF1 played an important role in many functions. |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
Molecular Mass : | 64 kDa |
AA Sequence : | IQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQ GQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRV LLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAV SDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSE LITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEP |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconsititute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconsitution with 200 μl 50% glycerol solution is recommended for longer term storage.If a different concentration is needed for your purposes please adjust the reconsitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconsituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | EBF1 early B-cell factor 1 [ Homo sapiens ] |
Official Symbol | EBF1 |
Synonyms | EBF1; early B-cell factor 1; early B cell factor , EBF; transcription factor COE1; OLF1; OE-1; olfactory neuronal transcription factor 1; Collier, Olf and EBF transcription factor 1; EBF; COE1; O/E-1; FLJ39389; FLJ41763; |
Gene ID | 1879 |
mRNA Refseq | NM_024007 |
Protein Refseq | NP_076870 |
MIM | 164343 |
UniProt ID | Q9UH73 |
Chromosome Location | 5q34 |
Pathway | Adipogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem; |
Function | C2H2 zinc finger domain binding; DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
EBF1-4138HF | Recombinant Full Length Human EBF1 Protein, GST-tagged | +Inquiry |
EBF1-3019H | Recombinant Human EBF1 Protein, GST-tagged | +Inquiry |
EBF1-27026TH | Recombinant Human EBF1 | +Inquiry |
EBF1-321H | Recombinant Human EBF1 protein, GST-tagged | +Inquiry |
EBF1-2019H | Recombinant Human EBF1 Protein (Asp179-Ser451), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBF1-6736HCL | Recombinant Human EBF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EBF1 Products
Required fields are marked with *
My Review for All EBF1 Products
Required fields are marked with *
0
Inquiry Basket