Recombinant Human EAF1 protein, GST-tagged

• Cat.No.: EAF1-3014H
• Product Overview: Recombinant Human EAF1 protein(NP_149074)(1-268 aa), fused with GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Protein length: 1-268 aa
• AA Sequence: MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EAF1 ELL associated factor 1 [ Homo sapiens ]
• Official Symbol: EAF1
• Synonyms: EAF1; ELL associated factor 1; ELL-associated factor 1; ELL (eleven nineteen lysine-rich leukemia gene)-associated factor 1
• Gene ID: 85403
• mRNA Refseq: NM_033083
• Protein Refseq: NP_149074
• MIM: 608315
• UniProt ID: Q96JC9