Recombinant Full Length Human EAF1 Protein, GST-tagged

• Cat.No.: EAF1-4121HF
• Product Overview: Human EAF1 full-length ORF ( AAH41329, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: EAF1 (ELL Associated Factor 1) is a Protein Coding gene. Diseases associated with EAF1 include Eaf. Among its related pathways are Gene Expression and Formation of HIV elongation complex in the absence of HIV Tat. An important paralog of this gene is EAF2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 55.22 kDa
• Protein length: 268 amino acids
• AA Sequence: MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EAF1 ELL associated factor 1 [ Homo sapiens ]
• Official Symbol: EAF1
• Synonyms: EAF1; ELL associated factor 1; ELL-associated factor 1; ELL (eleven nineteen lysine-rich leukemia gene)-associated factor 1
• Gene ID: 85403
• mRNA Refseq: NM_033083
• Protein Refseq: NP_149074
• MIM: 608315
• UniProt ID: Q96JC9