Recombinant Human E2F3

• Cat.No.: E2F3-27375TH
• Product Overview: Recombinant full length Human E2F3 with N terminal proprietary tag, 40.74kDa.

Specification

• Description: The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner. Two transcript variants encoding different isoforms have been found for this gene.
• Protein length: 133 amino acids
• Molecular Weight: 40.740kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFS SSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKC LLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVI LFASCTKLIFSKV
• Sequence Similarities: Belongs to the E2F/DP family.
• Tag: Non

Gene Information

• Gene Name: E2F3 E2F transcription factor 3 [ Homo sapiens ]
• Official Symbol: E2F3
• Synonyms: E2F3; E2F transcription factor 3; transcription factor E2F3
• Gene ID: 1871
• mRNA Refseq: NM_001243076
• Protein Refseq: NP_001230005
• MIM: 600427
• Uniprot ID: O00716
• Chromosome Location: 6p22
• Pathway: Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; CDC6 association with the ORC:origin complex, organism-specific biosystem
• Function: DNA binding; core promoter binding; cyclin-dependent protein kinase activity; protein binding; sequence-specific DNA binding transcription factor activity