Recombinant Full Length Human E2F3 Protein, GST-tagged

Description :	This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]
Source :	In Vitro Cell Free System
Species :	Human
Tag :	GST
Molecular Mass :	40.37 kDa
Protein length :	133 amino acids
AA Sequence :	MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	E2F3 E2F transcription factor 3 [ Homo sapiens ]
Official Symbol	E2F3
Synonyms	E2F3; E2F transcription factor 3; transcription factor E2F3; E2F-3; KIAA0075; MGC104598; DKFZp686C18211;
Gene ID	1871
mRNA Refseq	NM_001243076
Protein Refseq	NP_001230005
MIM	600427
UniProt ID	O00716