Recombinant Full Length Human E2F3 Protein, GST-tagged
Cat.No. : | E2F3-4112HF |
Product Overview : | Human E2F3 full-length ORF ( AAH16847, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 133 amino acids |
Description : | This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013] |
Molecular Mass : | 40.37 kDa |
AA Sequence : | MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | E2F3 E2F transcription factor 3 [ Homo sapiens ] |
Official Symbol | E2F3 |
Synonyms | E2F3; E2F transcription factor 3; transcription factor E2F3; E2F-3; KIAA0075; MGC104598; DKFZp686C18211; |
Gene ID | 1871 |
mRNA Refseq | NM_001243076 |
Protein Refseq | NP_001230005 |
MIM | 600427 |
UniProt ID | O00716 |
◆ Recombinant Proteins | ||
E2F3-27375TH | Recombinant Human E2F3 | +Inquiry |
E2F3-4932M | Recombinant Mouse E2F3 Protein | +Inquiry |
E2F3-3006H | Recombinant Human E2F3 Protein, GST-tagged | +Inquiry |
E2F3-2596M | Recombinant Mouse E2F3 Protein, His (Fc)-Avi-tagged | +Inquiry |
E2F3-4112HF | Recombinant Full Length Human E2F3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
E2F3-6742HCL | Recombinant Human E2F3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All E2F3 Products
Required fields are marked with *
My Review for All E2F3 Products
Required fields are marked with *
0
Inquiry Basket