Recombinant Human DYRK1A

Cat.No. : DYRK1A-26456TH
Product Overview : Recombinant fragment of Human DYRK1A protein with an N terminal proprietary tag; predicted mwt: 35.53 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5 UTR or in the 3 coding region. These variants encode at least five different isoforms.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVAS
Gene Name DYRK1A dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A [ Homo sapiens ]
Official Symbol DYRK1A
Synonyms DYRK1A; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A; DYRK, DYRK1, MNBH; dual specificity tyrosine-phosphorylation-regulated kinase 1A;
Gene ID 1859
mRNA Refseq NM_001396
Protein Refseq NP_001387
MIM 600855
Uniprot ID Q13627
Chromosome Location 21q22.13
Pathway Cell Cycle, Mitotic, organism-specific biosystem; G0 and Early G1, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Mitotic G1-G1/S phases, organism-specific biosystem;
Function ATP binding; kinase activity; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DYRK1A Products

Required fields are marked with *

My Review for All DYRK1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon