Recombinant Human DYRK1A

• Cat.No.: DYRK1A-26456TH
• Product Overview: Recombinant fragment of Human DYRK1A protein with an N terminal proprietary tag; predicted mwt: 35.53 kDa inclusive of tag.

Specification

• Description: This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome. Alternative splicing of this gene generates several transcript variants differing from each other either in the 5 UTR or in the 3 coding region. These variants encode at least five different isoforms.
• Protein length: 90 amino acids
• Molecular Weight: 35.530kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVAS
• Tag: Non

Gene Information

• Gene Name: DYRK1A dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A [ Homo sapiens ]
• Official Symbol: DYRK1A
• Synonyms: DYRK1A; dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A; DYRK, DYRK1, MNBH; dual specificity tyrosine-phosphorylation-regulated kinase 1A
• Gene ID: 1859
• mRNA Refseq: NM_001396
• Protein Refseq: NP_001387
• MIM: 600855
• Uniprot ID: Q13627
• Chromosome Location: 21q22.13
• Pathway: Cell Cycle, Mitotic, organism-specific biosystem; G0 and Early G1, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Mitotic G1-G1/S phases, organism-specific biosystem
• Function: ATP binding; kinase activity; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein binding