Recombinant Human DVL3

• Cat.No.: DVL3-28354TH
• Product Overview: Recombinant fragment of Human Dishevelled 3 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP*
• Sequence Similarities: Belongs to the DSH family.Contains 1 DEP domain.Contains 1 DIX domain.Contains 1 PDZ (DHR) domain.

Gene Information

• Gene Name: DVL3 dishevelled, dsh homolog 3 (Drosophila) [ Homo sapiens ]
• Official Symbol: DVL3
• Synonyms: DVL3; dishevelled, dsh homolog 3 (Drosophila); dishevelled 3 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-3; KIAA0208
• Gene ID: 1857
• mRNA Refseq: NM_004423
• Protein Refseq: NP_004414
• MIM: 601368
• Uniprot ID: Q92997
• Chromosome Location: 3q27
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; HTLV-I infection, organism-specific biosystem
• Function: beta-catenin binding; frizzled binding; protease binding; protein binding; protein heterodimerization activity