Recombinant Human DVL2, GST-tagged

Cat.No. : DVL2-107H
Product Overview : Recombinant Human DVL2(1 a.a. - 736 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 105.3 kDa
AA Sequence : MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDN ARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPE TETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTE QSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPID PAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIP NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDND GSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMAL PYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DVL2 dishevelled, dsh homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol DVL2
Synonyms DVL2; dishevelled, dsh homolog 2 (Drosophila); dishevelled 2 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-2; dishevelled 2 (homologous to Drosophila dsh); Dishevelled dsh homolog 2; Dishevelled-2; Dishevelled2; DSH homolog 2; DVL 2; Dvl2; DVL2_HUMAN; Segment polarity protein dishevelled homolog DVL 2; Segment polarity protein dishevelled homolog DVL-2; Segment polarity protein dishevelled homolog DVL2; DSH homolog 2; dishevelled-2; OTTHUMP00000128349
Gene ID 1856
mRNA Refseq NM_004422
Protein Refseq NP_004413
MIM 602151
UniProt ID O14641
Chromosome Location 17p13.1
Pathway Basal cell carcinoma; Canonical Wnt signaling pathway; DNA damage response (only ATM dependent)
Function frizzled binding; identical protein binding; protein binding; protein domain specific binding; protein self-association

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DVL2 Products

Required fields are marked with *

My Review for All DVL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon