Recombinant Human DUX4 Protein, GST-tagged
Cat.No. : | DUX4-2958H |
Product Overview : | Recombinant Human DUX4 protein(NP_001280727.1)(263-424 aa) was expressed in E.coli with a N-terminal GST tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 263-424 aa |
Description : | This gene is located within a D4Z4 repeat array in the subtelomeric region of chromosome 4q. The D4Z4 repeat is polymorphic in length; a similar D4Z4 repeat array has been identified on chromosome 10. Each D4Z4 repeat unit has an open reading frame (named DUX4) that encodes two homeoboxes; the repeat-array and ORF is conserved in other mammals. The encoded protein has been reported to function as a transcriptional activator of paired-like homeodomain transcription factor 1 (PITX1; GeneID 5307). Contraction of the macrosatellite repeat causes autosomal dominant facioscapulohumeral muscular dystrophy (FSHD). Alternative splicing results in multiple transcript variants. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Bio-activity : | Not Tested |
AA Sequence : | MPGKSREDRDPQRDGLPGPCAVAQPGPAQAGPQGQGVLAPPTSQGSPWWGWGRGPQVAGAAWEPQAGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL |
Endotoxin : | Please contact the lab for more information. |
Purity : | 65%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Applications : | Blocking peptide |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | DUX4 double homeobox 4 [ Homo sapiens (human) ] |
Official Symbol | DUX4 |
Synonyms | DUX4L |
Gene ID | 100288687 |
mRNA Refseq | NM_001293798.3 |
Protein Refseq | NP_001280727.1 |
MIM | 606009 |
UniProt ID | Q9UBX2 |
◆ Recombinant Proteins | ||
DUX4-4133HF | Recombinant Full Length Human DUX4 Protein, GST-tagged | +Inquiry |
DUX4-5857H | Recombinant Human DUX4 protein, His-tagged | +Inquiry |
DUX4-2957H | Recombinant Human DUX4 Protein, GST-tagged | +Inquiry |
DUX4-2958H | Recombinant Human DUX4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUX4 Products
Required fields are marked with *
My Review for All DUX4 Products
Required fields are marked with *
0
Inquiry Basket