Recombinant Human DUSP23 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DUSP23-2750H
• Product Overview: DUSP23 MS Standard C13 and N15-labeled recombinant protein (NP_060293) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).
• Molecular Mass: 16.6 kDa
• AA Sequence: MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DUSP23 dual specificity phosphatase 23 [ Homo sapiens (human) ]
• Official Symbol: DUSP23
• Synonyms: DUSP23; dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; FLJ20442; VH1-like member Z; VH1-like phosphatase Z; low molecular mass dual specificity phosphatase 3; low-molecular-mass dual-specificity phosphatase 3; VHZ; MOSP; LDP-3; RP11-190A12.1
• Gene ID: 54935
• mRNA Refseq: NM_017823
• Protein Refseq: NP_060293
• MIM: 618361
• UniProt ID: Q9BVJ7