Recombinant Full Length Human DUSP23 Protein, GST-tagged

• Cat.No.: DUSP23-4106HF
• Product Overview: Human DUSP23 full-length ORF ( NP_060293.2, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 150 amino acids
• Description: DUSP23 (Dual Specificity Phosphatase 23) is a Protein Coding gene. Diseases associated with DUSP23 include Neuronal Intestinal Dysplasia. GO annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is CDC14A.
• Molecular Mass: 43 kDa
• AA Sequence: MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUSP23 dual specificity phosphatase 23 [ Homo sapiens ]
• Official Symbol: DUSP23
• Synonyms: DUSP23; dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; FLJ20442; VH1-like member Z; VH1-like phosphatase Z; low molecular mass dual specificity phosphatase 3; low-molecular-mass dual-specificity phosphatase 3; VHZ; MOSP; LDP-3; RP11-190A12.1
• Gene ID: 54935
• mRNA Refseq: NM_017823
• Protein Refseq: NP_060293
• MIM: 618361
• UniProt ID: Q9BVJ7