Recombinant Human DUSP23, His-tagged

• Cat.No.: DUSP23-26909TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-150 of Human DUSP23, with an N-terminal His tag, 170aa, 18.8 kDa.

Specification

• Description: DUSP23, also known as low molecular mass dual specificity phosphatase 3(LDP-3), belongs to the protein-tyrosine phosphatase family.
• Protein length: 150 amino acids
• Conjugation: HIS
• Molecular Weight: 18.800kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Widely expressed. Highly expressed in spleen, prostate, colon, adrenal gland, mammary gland, thyroid and trachea. Expressed at lower level in uterus, small intestine, bladder, bone marrow, brain, spinal cord and stomach.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 0.58% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGVQPPNFSWVLPGRLAGLA LPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFG RTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK AVFQFYQRTK
• Sequence Similarities: Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain.

Gene Information

• Gene Name: DUSP23 dual specificity phosphatase 23 [ Homo sapiens ]
• Official Symbol: DUSP23
• Synonyms: DUSP23; dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; FLJ20442
• Gene ID: 54935
• mRNA Refseq: NM_017823
• Protein Refseq: NP_060293
• Uniprot ID: Q9BVJ7
• Chromosome Location: 1q23.1
• Function: hydrolase activity; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity