Recombinant Human DUSP23, His-tagged

Cat.No. : DUSP23-26909TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-150 of Human DUSP23, with an N-terminal His tag, 170aa, 18.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 150 amino acids
Description : DUSP23, also known as low molecular mass dual specificity phosphatase 3(LDP-3), belongs to the protein-tyrosine phosphatase family.
Conjugation : HIS
Molecular Weight : 18.800kDa inclusive of tags
Tissue specificity : Widely expressed. Highly expressed in spleen, prostate, colon, adrenal gland, mammary gland, thyroid and trachea. Expressed at lower level in uterus, small intestine, bladder, bone marrow, brain, spinal cord and stomach.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGVQPPNFSWVLPGRLAGLA LPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFG RTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK AVFQFYQRTK
Sequence Similarities : Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.Contains 1 tyrosine-protein phosphatase domain.
Gene Name DUSP23 dual specificity phosphatase 23 [ Homo sapiens ]
Official Symbol DUSP23
Synonyms DUSP23; dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; FLJ20442;
Gene ID 54935
mRNA Refseq NM_017823
Protein Refseq NP_060293
Uniprot ID Q9BVJ7
Chromosome Location 1q23.1
Function hydrolase activity; protein tyrosine phosphatase activity; protein tyrosine/serine/threonine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DUSP23 Products

Required fields are marked with *

My Review for All DUSP23 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon