Recombinant Human DUSP23 protein, GST-tagged

• Cat.No.: DUSP23-301625H
• Product Overview: Recombinant Human DUSP23 (1-150 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Lys150
• AA Sequence: MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: DUSP23 dual specificity phosphatase 23 [ Homo sapiens ]
• Official Symbol: DUSP23
• Synonyms: DUSP23; dual specificity phosphatase 23; dual specificity protein phosphatase 23; DUSP25; FLJ20442; VH1-like member Z; VH1-like phosphatase Z; low molecular mass dual specificity phosphatase 3; low-molecular-mass dual-specificity phosphatase 3; VHZ; MOSP; LDP-3; RP11-190A12.1
• Gene ID: 54935
• mRNA Refseq: NM_017823
• Protein Refseq: NP_060293
• UniProt ID: Q9BVJ7