Recombinant Human DUSP19 Protein, GST-tagged

• Cat.No.: DUSP19-2932H
• Product Overview: Human DUSP19 full-length ORF ( AAH35000, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP19 contains a variation of the consensus DUSP C-terminal catalytic domain, with the last serine residue replaced by alanine, and lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]
• Molecular Mass: 49.61 kDa
• AA Sequence: MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGCGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESDKCDRIQENSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUSP19 dual specificity phosphatase 19 [ Homo sapiens ]
• Official Symbol: DUSP19
• Synonyms: DUSP19; dual specificity phosphatase 19; dual specificity protein phosphatase 19; DUSP17; SKRP1; LMW-DSP3; protein phosphatase SKRP1; dual specificity phosphatase TS-DSP1; SAPK pathway-regulating phosphatase 1; low molecular weight dual specificity phosphatase 3; stress-activated protein kinase pathway-regulating phosphatase 1; LMWDSP3; TS-DSP1; MGC138210
• Gene ID: 142679
• mRNA Refseq: NM_001142314
• Protein Refseq: NP_001135786
• MIM: 611437
• UniProt ID: Q8WTR2