Recombinant Human DUSP18 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DUSP18-3932H
• Product Overview: DUSP18 MS Standard C13 and N15-labeled recombinant protein (NP_689724) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs.
• Molecular Mass: 20.9 kDa
• AA Sequence: MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DUSP18 dual specificity phosphatase 18 [ Homo sapiens (human) ]
• Official Symbol: DUSP18
• Synonyms: DUSP18; dual specificity phosphatase 18; dual specificity protein phosphatase 18; DUSP20; LMW-DSP20; low molecular weight dual specificity phosphatase 20; DSP18; LMWDSP20; bK963H5.1; MGC32658
• Gene ID: 150290
• mRNA Refseq: NM_152511
• Protein Refseq: NP_689724
• MIM: 611446
• UniProt ID: Q8NEJ0