Recombinant Human DUSP1 protein, GST-tagged

• Cat.No.: DUSP1-32H
• Product Overview: Recombinant Human DUSP1(305 a.a. - 367 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 305-367 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 32.67 kDa
• AA Sequence: LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: DUSP1 dual specificity phosphatase 1 [ Homo sapiens ]
• Official Symbol: DUSP1
• Synonyms: DUSP1; dual specificity phosphatase 1; PTPN10; dual specificity protein phosphatase 1; CL100; HVH1; MKP 1; MAP kinase phosphatase 1; protein-tyrosine phosphatase CL100; dual specificity protein phosphatase hVH1; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 1; MKP1; MKP-1
• Gene ID: 1843
• mRNA Refseq: NM_004417
• Protein Refseq: NP_004408
• MIM: 600714
• UniProt ID: P28562
• Chromosome Location: 5q35.1
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem