Recombinant Human DRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DRG1-3876H
• Product Overview: DRG1 MS Standard C13 and N15-labeled recombinant protein (NP_004138) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Critical regulator of cell growth under specific conditions. Implicated in differentiation and cell cycle arrest.
• Molecular Mass: 40.5 kDa
• AA Sequence: MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DRG1 developmentally regulated GTP binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: DRG1
• Synonyms: developmentally regulated GTP binding protein 1; 3029; Ensembl:ENSG00000185721; DKFZp434N1827; developmentally-regulated GTP-binding protein 1;DRG-1;NEDD-3;developmentally regulated GTP-binding protein 1;neural precursor cell expressed, developmentally down-regulated 3;neural precursor cell expressed developmentally down-regulated protein 3; NEDD3
• Gene ID: 4733
• mRNA Refseq: NM_004147
• Protein Refseq: NP_004138
• MIM: 603952
• UniProt ID: Q9Y295