Recombinant Human DRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DRG1-3876H |
Product Overview : | DRG1 MS Standard C13 and N15-labeled recombinant protein (NP_004138) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Critical regulator of cell growth under specific conditions. Implicated in differentiation and cell cycle arrest. |
Molecular Mass : | 40.5 kDa |
AA Sequence : | MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DRG1 developmentally regulated GTP binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | DRG1 |
Synonyms | developmentally regulated GTP binding protein 1; 3029; Ensembl:ENSG00000185721; DKFZp434N1827; developmentally-regulated GTP-binding protein 1;DRG-1;NEDD-3;developmentally regulated GTP-binding protein 1;neural precursor cell expressed, developmentally down-regulated 3;neural precursor cell expressed developmentally down-regulated protein 3; NEDD3 |
Gene ID | 4733 |
mRNA Refseq | NM_004147 |
Protein Refseq | NP_004138 |
MIM | 603952 |
UniProt ID | Q9Y295 |
◆ Recombinant Proteins | ||
DRG1-12166H | Recombinant Human DRG1, GST-tagged | +Inquiry |
DRG1-4193HF | Recombinant Full Length Human DRG1 Protein, GST-tagged | +Inquiry |
DRG1-3256C | Recombinant Chicken DRG1 | +Inquiry |
Drg1-2661M | Recombinant Mouse Drg1 Protein, Myc/DDK-tagged | +Inquiry |
DRG1-3876H | Recombinant Human DRG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DRG1-6815HCL | Recombinant Human DRG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DRG1 Products
Required fields are marked with *
My Review for All DRG1 Products
Required fields are marked with *
0
Inquiry Basket