Recombinant Full Length Human DRG1 Protein, GST-tagged

• Cat.No.: DRG1-4193HF
• Product Overview: Human DRG1 full-length ORF ( AAH19285, 1 a.a. - 367 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 367 amino acids
• Description: DRG1 (Developmentally Regulated GTP Binding Protein 1) is a Protein Coding gene. GO annotations related to this gene include identical protein binding and transcription factor binding.
• Molecular Mass: 66.11 kDa
• AA Sequence: MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGVKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DRG1 developmentally regulated GTP binding protein 1 [ Homo sapiens ]
• Official Symbol: DRG1
• Synonyms: developmentally regulated GTP binding protein 1; 3029; Ensembl:ENSG00000185721; DKFZp434N1827; developmentally-regulated GTP-binding protein 1;DRG-1;NEDD-3;developmentally regulated GTP-binding protein 1;neural precursor cell expressed, developmentally down-regulated 3;neural precursor cell expressed developmentally down-regulated protein 3; NEDD3
• Gene ID: 4733
• mRNA Refseq: NM_004147
• Protein Refseq: NP_004138
• MIM: 603952
• UniProt ID: Q9Y295