Recombinant Full Length Human DPT Protein, GST-tagged

• Cat.No.: DPT-4156HF
• Product Overview: Human DPT full-length ORF ( NP_001928.2, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.4 kDa
• Protein length: 201 amino acids
• AA Sequence: MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DPT dermatopontin [ Homo sapiens ]
• Official Symbol: DPT
• Synonyms: DPT; dermatopontin; tyrosine-rich acidic matrix protein; TRAMP
• Gene ID: 1805
• mRNA Refseq: NM_001937
• Protein Refseq: NP_001928
• MIM: 125597
• UniProt ID: Q07507