Recombinant Human DPP9 protein, His-tagged

• Cat.No.: DPP9-675H
• Product Overview: Recombinant Human DPP9 protein(Q86TI2)(585-788aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Protein length: 585-788a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.7 kDa
• AASequence: LHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVAL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: DPP9 dipeptidyl-peptidase 9 [ Homo sapiens ]
• Official Symbol: DPP9
• Synonyms: DPP9; dipeptidyl-peptidase 9; dipeptidylpeptidase 9; dipeptidyl peptidase 9; DPP IX; dipeptidyl peptidase IX; dipeptidyl peptidase-like protein 9; dipeptidyl peptidase IV-related protein 2; dipeptidyl peptidase IV-related protein-2; DP9; DPLP9; DPRP2; DPRP-2; FLJ16073; DKFZp762F117
• Gene ID: 91039
• mRNA Refseq: NM_139159
• Protein Refseq: NP_631898
• MIM: 608258
• UniProt ID: Q86TI2