Recombinant Human DPP9 protein, His-tagged
Cat.No. : | DPP9-675H |
Product Overview : | Recombinant Human DPP9 protein(Q86TI2)(585-788aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 585-788a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVAL |
Gene Name | DPP9 dipeptidyl-peptidase 9 [ Homo sapiens ] |
Official Symbol | DPP9 |
Synonyms | DPP9; dipeptidyl-peptidase 9; dipeptidylpeptidase 9; dipeptidyl peptidase 9; DPP IX; dipeptidyl peptidase IX; dipeptidyl peptidase-like protein 9; dipeptidyl peptidase IV-related protein 2; dipeptidyl peptidase IV-related protein-2; DP9; DPLP9; DPRP2; DPRP-2; FLJ16073; DKFZp762F117; |
Gene ID | 91039 |
mRNA Refseq | NM_139159 |
Protein Refseq | NP_631898 |
MIM | 608258 |
UniProt ID | Q86TI2 |
◆ Recombinant Proteins | ||
DPP9-2508M | Recombinant Mouse DPP9 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPP9-1377H | Recombinant Human DPP9 Protein, His-tagged | +Inquiry |
DPP9-28434TH | Recombinant Human DPP9 | +Inquiry |
DPP9-2427H | Recombinant Human DPP9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DPP9-675H | Recombinant Human DPP9 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPP9-6828HCL | Recombinant Human DPP9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPP9 Products
Required fields are marked with *
My Review for All DPP9 Products
Required fields are marked with *
0
Inquiry Basket