Recombinant Human DPP9 Protein, GST-tagged

• Cat.No.: DPP9-2851H
• Product Overview: Human DPP9 partial ORF ( NP_631898.2, 24 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that is a member of the S9B family in clan SC of the serine proteases. The protein has been shown to have post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Although the activity of this protein is similar to that of dipeptidyl peptidase 4 (DPP4), it does not appear to be membrane bound. In general, dipeptidyl peptidases appear to be involved in the regulation of the activity of their substrates and have been linked to a variety of diseases including type 2 diabetes, obesity and cancer. Several transcript variants of this gene have been described but not fully characterized. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.3 kDa
• AA Sequence: FQVQKHSWDGLRSIIHGSRKYSGLIVNKAPHDFQFVQKTDESGPHSHRLYYLGMPYGSRENSLLYSEIPKKVRKEALLLLSWKQMLDHFQATPHHG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DPP9 dipeptidyl-peptidase 9 [ Homo sapiens ]
• Official Symbol: DPP9
• Synonyms: DPP9; dipeptidyl-peptidase 9; dipeptidylpeptidase 9; dipeptidyl peptidase 9; DPP IX; dipeptidyl peptidase IX; dipeptidyl peptidase-like protein 9; dipeptidyl peptidase IV-related protein 2; dipeptidyl peptidase IV-related protein-2; DP9; DPLP9; DPRP2; DPRP-2; FLJ16073; DKFZp762F117
• Gene ID: 91039
• mRNA Refseq: NM_139159
• Protein Refseq: NP_631898
• MIM: 608258
• UniProt ID: Q86TI2