Recombinant Human DOT1L Protein, GST-tagged

• Cat.No.: DOT1L-2821H
• Product Overview: Human DOT1L partial ORF ( NP_115871, 3 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a histone methyltransferase that methylates lysine-79 of histone H3. It is inactive against free core histones, but shows significant histone methyltransferase activity against nucleosomes. [provided by RefSeq, Aug 2011]
• Molecular Mass: 37.4 kDa
• AA Sequence: EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DOT1L DOT1-like, histone H3 methyltransferase (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DOT1L
• Synonyms: DOT1L; DOT1-like, histone H3 methyltransferase (S. cerevisiae); histone-lysine N-methyltransferase, H3 lysine-79 specific; DOT1; histone methyltransferase DOT1L; KIAA1814; KMT4; H3-K79-HMTase; DOT1-like protein; lysine N-methyltransferase 4; histone H3-K79 methyltransferase; DKFZp586P1823
• Gene ID: 84444
• mRNA Refseq: NM_032482
• Protein Refseq: NP_115871
• MIM: 607375
• UniProt ID: Q8TEK3