Recombinant Human DOK2, His-tagged

• Cat.No.: DOK2-28083TH
• Product Overview: Recombinant fragment, corresponding to amino acids 21-133 of Human DOK2 with a N terminal His tag; Predicted MWt 13 kDa:

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-133 a.a.
• Description: The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein whose presence is associated with CML. This encoded protein binds p120 (RasGAP) from CML cells.
• Conjugation: HIS
• Tissue specificity: Highly expressed in peripheral blood leukocytes, lymph nodes and spleen. Lower expression in thymus, bone marrow and fetal liver.
• Form: Lyophilised:Reconstitution with 76 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVI RLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAP AAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCM
• Sequence Similarities: Belongs to the DOK family. Type A subfamily.Contains 1 IRS-type PTB domain.Contains 1 PH domain.

Gene Information

• Gene Name: DOK2 docking protein 2, 56kDa [ Homo sapiens ]
• Official Symbol: DOK2
• Synonyms: DOK2; docking protein 2, 56kDa; docking protein 2, 56kD; docking protein 2; Dok 2; p56dok 2
• Gene ID: 9046
• mRNA Refseq: NM_003974
• Protein Refseq: NP_003965
• MIM: 604997
• Uniprot ID: O60496
• Chromosome Location: 8p21.3
• Pathway: Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem
• Function: insulin receptor binding; receptor signaling protein activity; transmembrane receptor protein tyrosine kinase adaptor activity