Recombinant Human DNASE2B Protein, GST-tagged

• Cat.No.: DNASE2B-2781H
• Product Overview: Human DNASE2B full-length ORF ( NP_490649.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 44.2 kDa
• AA Sequence: MPQLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNASE2B deoxyribonuclease II beta [ Homo sapiens ]
• Official Symbol: DNASE2B
• Synonyms: DNASE2B; deoxyribonuclease II beta; deoxyribonuclease-2-beta; DLAD; DNase II beta; endonuclease DLAD; lysosomal DNase II; DNase2-like acid DNase; DNase II-like acid DNase
• Gene ID: 58511
• mRNA Refseq: NM_021233
• Protein Refseq: NP_067056
• MIM: 608057
• UniProt ID: Q8WZ79