Recombinant Human DNASE1L3

• Cat.No.: DNASE1L3-26157TH
• Product Overview: Recombinant Human DNASE1L3 (51 a.a. - 150 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: This gene encodes a member of the deoxyribonuclease I family. The encoded protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Mutations in this gene are a cause of systemic lupus erythematosus-16. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Molecular Mass: 36.63 kDa
• AA Sequence: RCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDG DADVFSREPFVVWFQSPHTAVKDFV
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens (human) ]
• Official Symbol: DNASE1L3
• Synonyms: DNASE1L3; deoxyribonuclease I-like 3; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I-like 3; DNase gamma; LS-DNase; Liver and spleen DNase; deoxyribonuclease I-like III; deoxyribonuclease gamma; DHP2, DNAS1L3; EC 3.1.21.-
• Gene ID: 1776
• mRNA Refseq: NM_004944
• Protein Refseq: NP_004935
• MIM: 602244
• UniProt ID: Q13609
• Chromosome Location: 3p14.3
• Function: DNA binding; calcium ion binding; deoxyribonuclease activity; endodeoxyribonuclease activity; endodeoxyribonuclease activity, producing 5''-phosphomonoesters