Recombinant Human DNASE1L3 Protein, His-tagged

• Cat.No.: DNASE1L3-2790H
• Product Overview: Recombinant Human DNASE1L3 Protein is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.

Specification

• Source: Baculovirus
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.8 kDa
• AA Sequence: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
• Full Length: Full L.

Gene Information

• Gene Name: DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens ]
• Official Symbol: DNASE1L3
• Synonyms: DNASE1L3; deoxyribonuclease I-like 3; DNAS1L3; DNase gamma; LSD; LS-DNase; DNase I-like 3; Liver and spleen DNase; DHP2; SLEB16
• Gene ID: 1776
• mRNA Refseq: NM_001256560
• Protein Refseq: NP_001243489
• MIM: 602244
• UniProt ID: Q13609