Recombinant Human DNAJC9 Protein, GST-tagged

• Cat.No.: DNAJC9-2770H
• Product Overview: Human DNAJC9 full-length ORF (BAG52832.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DNAJC9 (DnaJ Heat Shock Protein Family (Hsp40) Member C9) is a Protein Coding gene. Diseases associated with DNAJC9 include Corneal Degeneration and Recurrent Corneal Erosion.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.3 kDa
• AA Sequence: MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIGAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens ]
• Official Symbol: DNAJC9
• Synonyms: DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; DnaJ protein SB73; HDJC9; KIAA0974
• Gene ID: 23234
• mRNA Refseq: NM_015190
• Protein Refseq: NP_056005
• MIM: 611206
• UniProt ID: Q8WXX5