Recombinant Human DNAJC9, His-tagged
Cat.No. : | DNAJC9-26639TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-188 of Human DNAJC9 with an N terminal His tag. Observed mwt: 22 kDa;predicted mwt: 22 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-188 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 64 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSL QVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVY DEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEK TYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEE PRIRNIIQQAIDAGEVPSYNAFVKESKQKMNA |
Sequence Similarities : | Contains 1 J domain. |
Gene Name | DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens ] |
Official Symbol | DNAJC9 |
Synonyms | DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; |
Gene ID | 23234 |
mRNA Refseq | NM_015190 |
Protein Refseq | NP_056005 |
MIM | 611206 |
Uniprot ID | Q8WXX5 |
Chromosome Location | 10q22.3 |
Function | heat shock protein binding; unfolded protein binding; |
◆ Recombinant Proteins | ||
Dnajc9-378M | Recombinant Mouse Dnajc9 Protein, MYC/DDK-tagged | +Inquiry |
DNAJC9-4722M | Recombinant Mouse DNAJC9 Protein | +Inquiry |
DNAJC9-26775TH | Recombinant Human DNAJC9, His-tagged | +Inquiry |
DNAJC9-26639TH | Recombinant Human DNAJC9, His-tagged | +Inquiry |
DNAJC9-1357H | Recombinant Human DNAJC9 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC9-6869HCL | Recombinant Human DNAJC9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJC9 Products
Required fields are marked with *
My Review for All DNAJC9 Products
Required fields are marked with *
0
Inquiry Basket