Recombinant Human DNAJC5G Protein, GST-tagged

• Cat.No.: DNAJC5G-2765H
• Product Overview: Human DNAJC5G full-length ORF ( NP_775921.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DNAJC5G (DnaJ Heat Shock Protein Family (Hsp40) Member C5 Gamma) is a Protein Coding gene. Among its related pathways are Protein processing in endoplasmic reticulum. An important paralog of this gene is DNAJC5.
• Molecular Mass: 47.8 kDa
• AA Sequence: MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma [ Homo sapiens ]
• Official Symbol: DNAJC5G
• Synonyms: DNAJC5G; DnaJ (Hsp40) homolog, subfamily C, member 5 gamma; dnaJ homolog subfamily C member 5G; CSP gamma; FLJ40417; gamma-CSP; cysteine string protein-gamma; gamma cysteine string protein; gamma-cysteine string protein; CSP-gamma
• Gene ID: 285126
• mRNA Refseq: NM_173650
• Protein Refseq: NP_775921
• MIM: 613946
• UniProt ID: Q8N7S2