Recombinant Full Length Human DNAJC5G Protein, GST-tagged
Cat.No. : | DNAJC5G-4022HF |
Product Overview : | Human DNAJC5G full-length ORF ( NP_775921.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 189 amino acids |
Description : | DNAJC5G (DnaJ Heat Shock Protein Family (Hsp40) Member C5 Gamma) is a Protein Coding gene. Among its related pathways are Protein processing in endoplasmic reticulum. An important paralog of this gene is DNAJC5. |
Molecular Mass : | 47.8 kDa |
AA Sequence : | MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAJC5G DnaJ (Hsp40) homolog, subfamily C, member 5 gamma [ Homo sapiens ] |
Official Symbol | DNAJC5G |
Synonyms | DNAJC5G; DnaJ (Hsp40) homolog, subfamily C, member 5 gamma; dnaJ homolog subfamily C member 5G; CSP gamma; FLJ40417; gamma-CSP; cysteine string protein-gamma; gamma cysteine string protein; gamma-cysteine string protein; CSP-gamma; |
Gene ID | 285126 |
mRNA Refseq | NM_173650 |
Protein Refseq | NP_775921 |
MIM | 613946 |
UniProt ID | Q8N7S2 |
◆ Recombinant Proteins | ||
DNAJC5G-4022HF | Recombinant Full Length Human DNAJC5G Protein, GST-tagged | +Inquiry |
DNAJC5G-2765H | Recombinant Human DNAJC5G Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC5G-6871HCL | Recombinant Human DNAJC5G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJC5G Products
Required fields are marked with *
My Review for All DNAJC5G Products
Required fields are marked with *
0
Inquiry Basket