Recombinant Human DNAJC3

• Cat.No.: DNAJC3-26638TH
• Product Overview: Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 234 amino acids
• Description: This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR).
• Molecular Weight: 51.850kDa inclusive of tags
• Tissue specificity: Widely expressed with high level in the pancreas and testis. Also expressed in cell lines with different levels.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
• Sequence Similarities: Contains 1 J domain.Contains 9 TPR repeats.

Gene Information

• Gene Name: DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ]
• Official Symbol: DNAJC3
• Synonyms: DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK
• Gene ID: 5611
• mRNA Refseq: NM_006260
• Protein Refseq: NP_006251
• MIM: 601184
• Uniprot ID: Q13217
• Chromosome Location: 13q32
• Pathway: Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Influenza Infection, organism-specific biosystem
• Function: binding; chaperone binding; heat shock protein binding; misfolded protein binding; protein kinase inhibitor activity