Recombinant Human DNAJC3
| Cat.No. : | DNAJC3-26638TH |
| Product Overview : | Recombinant full length Human DNAJC3 with N-terminal proprietary tag, 51.85 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). |
| Protein length : | 234 amino acids |
| Molecular Weight : | 51.850kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Widely expressed with high level in the pancreas and testis. Also expressed in cell lines with different levels. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKH LELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATV FLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGK LDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKK VTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSC LRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS |
| Sequence Similarities : | Contains 1 J domain.Contains 9 TPR repeats. |
| Tag : | Non |
| Gene Name | DNAJC3 DnaJ (Hsp40) homolog, subfamily C, member 3 [ Homo sapiens ] |
| Official Symbol | DNAJC3 |
| Synonyms | DNAJC3; DnaJ (Hsp40) homolog, subfamily C, member 3; PRKRI; dnaJ homolog subfamily C member 3; HP58; P58; P58IPK; |
| Gene ID | 5611 |
| mRNA Refseq | NM_006260 |
| Protein Refseq | NP_006251 |
| MIM | 601184 |
| Uniprot ID | Q13217 |
| Chromosome Location | 13q32 |
| Pathway | Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Influenza Infection, organism-specific biosystem; |
| Function | binding; chaperone binding; heat shock protein binding; misfolded protein binding; protein kinase inhibitor activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJC3 Products
Required fields are marked with *
My Review for All DNAJC3 Products
Required fields are marked with *
0
Inquiry Basket
