Recombinant Human DNAJC24 Protein, GST-tagged

• Cat.No.: DNAJC24-2758H
• Product Overview: Human DNAJC24 full-length ORF (1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2; MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 42.68 kDa
• AA Sequence: MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJC24 DnaJ (Hsp40) homolog, subfamily C, member 24 [ Homo sapiens ]
• Official Symbol: DNAJC24
• Synonyms: DNAJC24; DnaJ (Hsp40) homolog, subfamily C, member 24; DPH4, DPH4 homolog (JJJ3, S. cerevisiae) , DPH4, JJJ3 homolog (S. cerevisiae) , ZCSL3, zinc finger, CSL type containing 3; dnaJ homolog subfamily C member 24; JJJ3; 1700030A21Rik; DPH4, JJJ3 homolog; DPH4 homolog (JJJ3, S. cerevisiae); zinc finger, CSL-type containing 3; zinc finger, CSL domain containing 3; CSL-type zinc finger-containing protein 3; DPH4; ZCSL3
• Gene ID: 120526
• mRNA Refseq: NM_181706
• Protein Refseq: NP_859057
• MIM: 611072
• UniProt ID: Q6P3W2