Recombinant Human DNAJC24 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DNAJC24-6289H
• Product Overview: DNAJC24 MS Standard C13 and N15-labeled recombinant protein (NP_859057) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17 kDa
• AA Sequence: MAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DNAJC24 DnaJ heat shock protein family (Hsp40) member C24 [ Homo sapiens (human) ]
• Official Symbol: DNAJC24
• Synonyms: DNAJC24; DnaJ (Hsp40) homolog, subfamily C, member 24; DPH4, DPH4 homolog (JJJ3, S. cerevisiae), DPH4, JJJ3 homolog (S. cerevisiae), ZCSL3, zinc finger, CSL type containing 3; dnaJ homolog subfamily C member 24; JJJ3; 1700030A21Rik; DPH4, JJJ3 homolog; DPH4 homolog (JJJ3, S. cerevisiae); zinc finger, CSL-type containing 3; zinc finger, CSL domain containing 3; CSL-type zinc finger-containing protein 3; DPH4; ZCSL3
• Gene ID: 120526
• mRNA Refseq: NM_181706
• Protein Refseq: NP_859057
• MIM: 611072
• UniProt ID: Q6P3W2