Recombinant Human DMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DMC1-4107H
• Product Overview: DMC1 MS Standard C13 and N15-labeled recombinant protein (NP_008999) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the superfamily of recombinases (also called DNA strand-exchange proteins). Recombinases are important for repairing double-strand DNA breaks during mitosis and meiosis. This protein, which is evolutionarily conserved, is reported to be essential for meiotic homologous recombination and may thus play an important role in generating diversity of genetic information. Alternative splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 37.7 kDa
• AA Sequence: MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DMC1 DNA meiotic recombinase 1 [ Homo sapiens (human) ]
• Official Symbol: DMC1
• Synonyms: DMC1; DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast); DMC1 (dosage suppressor of mck1, yeast homolog) meiosis specific homologous recombination; meiotic recombination protein DMC1/LIM15 homolog; LIM15; DMC1 homologue; disrupted meiotic cDNA1, yeast, homolog of; DMC1H; HsLim15; dJ199H16.1; MGC150472; MGC150473
• Gene ID: 11144
• mRNA Refseq: NM_007068
• Protein Refseq: NP_008999
• MIM: 602721
• UniProt ID: Q14565