Recombinant Human DMC1 Protein, GST-tagged

Cat.No. : DMC1-2703H
Product Overview : Human DMC1 partial ORF ( NP_008999, 237 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the superfamily of recombinases (also called DNA strand-exchange proteins). Recombinases are important for repairing double-strand DNA breaks during mitosis and meiosis. This protein, which is evolutionarily conserved, is reported to be essential for meiotic homologous recombination and may thus play an important role in generating diversity of genetic information. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
Molecular Mass : 37.07 kDa
AA Sequence : GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DMC1 DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast) [ Homo sapiens ]
Official Symbol DMC1
Synonyms DMC1; DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast); DMC1 (dosage suppressor of mck1, yeast homolog) meiosis specific homologous recombination; meiotic recombination protein DMC1/LIM15 homolog; LIM15; DMC1 homologue; disrupted meiotic cDNA1, yeast, homolog of; DMC1H; HsLim15; dJ199H16.1; MGC150472; MGC150473;
Gene ID 11144
mRNA Refseq NM_007068
Protein Refseq NP_008999
MIM 602721
UniProt ID Q14565

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DMC1 Products

Required fields are marked with *

My Review for All DMC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon