Recombinant Human DMC1 Protein, GST-tagged
Cat.No. : | DMC1-2703H |
Product Overview : | Human DMC1 partial ORF ( NP_008999, 237 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the superfamily of recombinases (also called DNA strand-exchange proteins). Recombinases are important for repairing double-strand DNA breaks during mitosis and meiosis. This protein, which is evolutionarily conserved, is reported to be essential for meiotic homologous recombination and may thus play an important role in generating diversity of genetic information. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
Molecular Mass : | 37.07 kDa |
AA Sequence : | GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DMC1 DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast) [ Homo sapiens ] |
Official Symbol | DMC1 |
Synonyms | DMC1; DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast); DMC1 (dosage suppressor of mck1, yeast homolog) meiosis specific homologous recombination; meiotic recombination protein DMC1/LIM15 homolog; LIM15; DMC1 homologue; disrupted meiotic cDNA1, yeast, homolog of; DMC1H; HsLim15; dJ199H16.1; MGC150472; MGC150473; |
Gene ID | 11144 |
mRNA Refseq | NM_007068 |
Protein Refseq | NP_008999 |
MIM | 602721 |
UniProt ID | Q14565 |
◆ Recombinant Proteins | ||
DMC1-2703H | Recombinant Human DMC1 Protein, GST-tagged | +Inquiry |
DMC1-1309HFL | Recombinant Full Length Human DMC1 Protein, C-Flag-tagged | +Inquiry |
DMC1-12035H | Recombinant Human DMC1, GST-tagged | +Inquiry |
DMC1-4107H | Recombinant Human DMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Dmc1-2583M | Recombinant Mouse Dmc1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMC1-6900HCL | Recombinant Human DMC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DMC1 Products
Required fields are marked with *
My Review for All DMC1 Products
Required fields are marked with *
0
Inquiry Basket