Recombinant Human DMAP1 Protein, GST-tagged
Cat.No. : | DMAP1-2699H |
Product Overview : | Human DMAP1 partial ORF ( NP_061973, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DMAP1 DNA methyltransferase 1 associated protein 1 [ Homo sapiens ] |
Official Symbol | DMAP1 |
Synonyms | DMAP1; DNA methyltransferase 1 associated protein 1; DNA methyltransferase 1-associated protein 1; DNMAP1; DNMTAP1; EAF2; FLJ11543; KIAA1425; MEAF2; SWC4; DNMT1 associated protein 1; DNMT1-associated protein 1; DKFZp686L09142; |
Gene ID | 55929 |
mRNA Refseq | NM_001034024 |
Protein Refseq | NP_001029196 |
MIM | 605077 |
UniProt ID | Q9NPF5 |
◆ Recombinant Proteins | ||
DMAP1-2699H | Recombinant Human DMAP1 Protein, GST-tagged | +Inquiry |
DMAP1-10594Z | Recombinant Zebrafish DMAP1 | +Inquiry |
Dmap1-2582M | Recombinant Mouse Dmap1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMAP1-6902HCL | Recombinant Human DMAP1 293 Cell Lysate | +Inquiry |
DMAP1-6901HCL | Recombinant Human DMAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DMAP1 Products
Required fields are marked with *
My Review for All DMAP1 Products
Required fields are marked with *
0
Inquiry Basket