Recombinant Human DMAP1 Protein, GST-tagged

• Cat.No.: DMAP1-2699H
• Product Overview: Human DMAP1 partial ORF ( NP_061973, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DMAP1 DNA methyltransferase 1 associated protein 1 [ Homo sapiens ]
• Official Symbol: DMAP1
• Synonyms: DMAP1; DNA methyltransferase 1 associated protein 1; DNA methyltransferase 1-associated protein 1; DNMAP1; DNMTAP1; EAF2; FLJ11543; KIAA1425; MEAF2; SWC4; DNMT1 associated protein 1; DNMT1-associated protein 1; DKFZp686L09142
• Gene ID: 55929
• mRNA Refseq: NM_001034024
• Protein Refseq: NP_001029196
• MIM: 605077
• UniProt ID: Q9NPF5