Recombinant Human DLX6 protein, GST-tagged

Cat.No. : DLX6-301124H
Product Overview : Recombinant Human DLX6 (110-175 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Gln110-Met175
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : QGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name DLX6 distal-less homeobox 6 [ Homo sapiens ]
Official Symbol DLX6
Synonyms DLX6; distal-less homeobox 6; distal less homeo box 6; homeobox protein DLX-6; distal-less homeo box 6; MGC125282; MGC125283; MGC125284; MGC125285;
Gene ID 1750
mRNA Refseq NM_005222
Protein Refseq NP_005213
MIM 600030
UniProt ID P56179

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DLX6 Products

Required fields are marked with *

My Review for All DLX6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon